PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_9214_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 298aa    MW: 34296.4 Da    PI: 6.9769
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_9214_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.4e-181461148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+WT+eEde+l++++k++G g+W++ ++  g+ R++k+c++rw +yl
  cra_locus_9214_iso_1_len_1133_ver_3 14 KGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLQRCGKSCRLRWINYL 61
                                         79********************************************97 PP

2Myb_DNA-binding59.48.1e-1967111147
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
  cra_locus_9214_iso_1_len_1133_ver_3  67 RGNFTEEEDELIINLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                                          89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.624961IPR017930Myb domain
SMARTSM007171.0E-131363IPR001005SANT/Myb domain
SuperFamilySSF466892.44E-3013108IPR009057Homeodomain-like
PfamPF002495.2E-161461IPR001005SANT/Myb domain
CDDcd001671.32E-111661No hitNo description
PROSITE profilePS5129428.93262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2865116IPR009057Homeodomain-like
SMARTSM007171.1E-1766114IPR001005SANT/Myb domain
PfamPF002496.3E-1767111IPR001005SANT/Myb domain
CDDcd001676.02E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGRSPCCEKE HTNKGAWTKE EDERLINYIK LHGEGCWRSL PKAAGLQRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIN LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLNRG  120
IDPQTHLPLN NSTTTTSSNM TTTTKTLQFH HTLYSSVPIA MMKSKAAPDQ LDDSNNSVLS  180
EELINSEINL ELTISPPHHH QHYSYPQQQE TDTNGFKKKK KKQKLHDEEE EAEEPFYLNF  240
GTNVDDDHDD NENVCLCYLG LIQSNTTSIT SVCHCSRIST HNVNIDNMHK YHTPPLSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29141167108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1217224KKKKKQKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097098.18e-97PREDICTED: myb-related protein 308-like
SwissprotP813932e-90MYB08_ANTMA; Myb-related protein 308
TrEMBLV7AVZ15e-94V7AVZ1_PHAVU; Uncharacterized protein
STRINGVIT_07s0130g00040.t017e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154